Lineage for d1bfs__ (1bfs -)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 223262Superfamily b.1.18: E set domains [81296] (17 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 223263Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (5 proteins)
  6. 223264Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species)
  7. 223269Species Mouse (Mus musculus) [TaxId:10090] [49250] (4 PDB entries)
  8. 223270Domain d1bfs__: 1bfs - [21927]

Details for d1bfs__

PDB Entry: 1bfs (more details), 2.2 Å

PDB Description: structure of nf-kb p50 homodimer bound to a kb site

SCOP Domain Sequences for d1bfs__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfs__ b.1.18.1 (-) p50 subunit of NF-kappa B transcription factor {Mouse (Mus musculus)}
asnlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvh
rqfaivfktpkykdvnitkpasvfvqlrrksdletsepkpflyype

SCOP Domain Coordinates for d1bfs__:

Click to download the PDB-style file with coordinates for d1bfs__.
(The format of our PDB-style files is described here.)

Timeline for d1bfs__: