SCOP 1.65: Domain d1nfib_: 1nfi B:

Lineage for d1nfib_ (1nfi B:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (5 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49249] (2 PDB entries)

8. Domain d1nfib_: 1nfi B: [21925]
   Other proteins in same PDB: d1nfia1, d1nfia2, d1nfic1, d1nfic2, d1nfie_, d1nfif_

Details for d1nfib_

PDB Entry: 1nfi, 2.7 Å

PDB Description: i-kappa-b-alpha/nf-kappa-b complex

SCOP Domain Sequences for d1nfib_:

Sequence; same for both SEQRES and ATOM records:

>d1nfib_ b.1.18.1 (B:) p50 subunit of NF-kappa B transcription factor {Human (Homo sapiens)}
snlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhr
qfaivfktpkykdinitkpasvfvqlrrksdletsepkpflyypeik

Timeline for d1nfib_:

• d1nfib_ first appeared (with stable ids) in SCOP 1.55
  
• d1nfib_ appears in SCOP 1.63
  
• d1nfib_ appears in SCOP 1.67
  
• d1nfib_ appears in the current release, SCOPe 2.08