SCOPe 2.08: Domain d4azra1: 4azr A:1-134

Lineage for d4azra1 (4azr A:1-134)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein automated matches [190295] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187133] (90 PDB entries)

8. Domain d4azra1: 4azr A:1-134 [219230]
   Other proteins in same PDB: d4azra2, d4azrb2
   automated match to d1b56a_
   complexed with a9m, cl

Details for d4azra1

PDB Entry: 4azr, 2.95 Å

PDB Description: Human epidermal fatty acid-binding protein (FABP5) in complex with the endocannabinoid anandamide

PDB Compounds: (A:) fatty acid-binding protein, epidermal

SCOPe Domain Sequences for d4azra1:

Sequence; same for both SEQRES and ATOM records:

>d4azra1 b.60.1.2 (A:1-134) automated matches {Human (Homo sapiens) [TaxId: 9606]}
matvqqlegrwrlvdskgfdeymkelgvgialrkmgamakpdciitcdgknltiktestv
kttqfsctlgekfeettadgrktqtvcnftdgalvqhqewdgkestitrklkdgklvvec
vmnnvtctriyekv

Timeline for d4azra1:

• d4azra1 first appeared in SCOPe 2.03, called d4azra_
  
• d4azra1 appears in SCOPe 2.07