Lineage for d1ayrc2 (1ayr C:183-368)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 104969Family b.1.1.5: E set domains [49208] (25 proteins)
  6. 104970Protein Arrestin [49244] (2 species)
  7. 104978Species Cow (Bos taurus), visual arrestin [TaxId:9913] [49245] (2 PDB entries)
  8. 104992Domain d1ayrc2: 1ayr C:183-368 [21920]

Details for d1ayrc2

PDB Entry: 1ayr (more details), 3.3 Å

PDB Description: arrestin from bovine rod outer segments

SCOP Domain Sequences for d1ayrc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ayrc2 b.1.1.5 (C:183-368) Arrestin {Cow (Bos taurus), visual arrestin}
dmgpqpraeaswqffmsdkplrlavslskeiyyhgepipvtvavtnstektvkkikvlve
qvtnvvlyssdyyiktvaaeeaqekvppnssltktltlvpllannrerrgialdgkikhe
dtnlasstiikegidktvmgilvsyqikvkltvsgllgeltssevatevpfrlmhpqped
pdtaka

SCOP Domain Coordinates for d1ayrc2:

Click to download the PDB-style file with coordinates for d1ayrc2.
(The format of our PDB-style files is described here.)

Timeline for d1ayrc2: