SCOPe 2.08: Domain d4ax4a2: 4ax4 A:431-710

Lineage for d4ax4a2 (4ax4 A:431-710)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [226476] (2 PDB entries)

8. Domain d4ax4a2: 4ax4 A:431-710 [219190]
   Other proteins in same PDB: d4ax4a1
   automated match to d1e5ta2
   complexed with gol; mutant

Details for d4ax4a2

PDB Entry: 4ax4, 1.6 Å

PDB Description: prolyl oligopeptidase from porcine brain, h680a mutant

PDB Compounds: (A:) prolyl oligopeptidase

SCOPe Domain Sequences for d4ax4a2:

Sequence; same for both SEQRES and ATOM records:

>d4ax4a2 c.69.1.0 (A:431-710) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
dasdyqtvqifypskdgtkipmfivhkkgikldgshpaflygyggfnisitpnysvsrli
fvrhmggvlavanirgggeygetwhkggilankqncfddfqcaaeylikegytspkrlti
nggsnggllvatcanqrpdlfgcviaqvgvmdmlkfhkytighawttdygcsdskqhfew
likysplhnvklpeaddiqypsmllltadhddrvvplhslkfiatlqyivgrsrkqnnpl
lihvdtkagagagkptakvieevsdmfafiarclnidwip

Timeline for d4ax4a2:

• d4ax4a2 first appeared in SCOPe 2.03
  
• d4ax4a2 appears in SCOPe 2.07