![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
![]() | Protein automated matches [190543] (131 species) not a true protein |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [226476] (2 PDB entries) |
![]() | Domain d4ax4a2: 4ax4 A:431-710 [219190] Other proteins in same PDB: d4ax4a1 automated match to d1e5ta2 complexed with gol; mutant |
PDB Entry: 4ax4 (more details), 1.6 Å
SCOPe Domain Sequences for d4ax4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ax4a2 c.69.1.0 (A:431-710) automated matches {Pig (Sus scrofa) [TaxId: 9823]} dasdyqtvqifypskdgtkipmfivhkkgikldgshpaflygyggfnisitpnysvsrli fvrhmggvlavanirgggeygetwhkggilankqncfddfqcaaeylikegytspkrlti nggsnggllvatcanqrpdlfgcviaqvgvmdmlkfhkytighawttdygcsdskqhfew likysplhnvklpeaddiqypsmllltadhddrvvplhslkfiatlqyivgrsrkqnnpl lihvdtkagagagkptakvieevsdmfafiarclnidwip
Timeline for d4ax4a2: