![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (20 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.11: Arrestin [81291] (1 protein) |
![]() | Protein Arrestin [49244] (2 species) duplication: contains tandem repeat of two elaborated Ig-like domains contacting each other head-to-head |
![]() | Species Cow (Bos taurus), visual arrestin [TaxId:9913] [49245] (2 PDB entries) |
![]() | Domain d1ayrc1: 1ayr C:1-182 [21919] |
PDB Entry: 1ayr (more details), 3.3 Å
SCOP Domain Sequences for d1ayrc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ayrc1 b.1.18.11 (C:1-182) Arrestin {Cow (Bos taurus), visual arrestin [TaxId: 9913]} mkankpapnhvifkkisrdksvtiylgkrdyidhvervepvdgvvlvdpelvkgkrvyvs ltcafrygqedidvmglsfrrdlyfsqvqvfppvgasgattrlqeslikklgantypfll tfpdylpcsvmlqpapqdvgkscgvdfeikafathstdveedkipkkssvrllirkvqha pr
Timeline for d1ayrc1: