Lineage for d1ayrc1 (1ayr C:1-182)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54510Family b.1.1.5: E set domains [49208] (24 proteins)
  6. 54511Protein Arrestin [49244] (1 species)
  7. 54512Species Cow (Bos taurus) [TaxId:9913] [49245] (2 PDB entries)
  8. 54525Domain d1ayrc1: 1ayr C:1-182 [21919]

Details for d1ayrc1

PDB Entry: 1ayr (more details), 3.3 Å

PDB Description: arrestin from bovine rod outer segments
PDB Compounds: (C:)

SCOP Domain Sequences for d1ayrc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ayrc1 b.1.1.5 (C:1-182) Arrestin {Cow (Bos taurus)}
mkankpapnhvifkkisrdksvtiylgkrdyidhvervepvdgvvlvdpelvkgkrvyvs
ltcafrygqedidvmglsfrrdlyfsqvqvfppvgasgattrlqeslikklgantypfll
tfpdylpcsvmlqpapqdvgkscgvdfeikafathstdveedkipkkssvrllirkvqha
pr

SCOP Domain Coordinates for d1ayrc1:

Click to download the PDB-style file with coordinates for d1ayrc1.
(The format of our PDB-style files is described here.)

Timeline for d1ayrc1: