Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) |
Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins) |
Protein automated matches [190229] (13 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187292] (114 PDB entries) |
Domain d4awqb_: 4awq B: [219185] automated match to d4awpb_ complexed with 592 |
PDB Entry: 4awq (more details), 1.6 Å
SCOPe Domain Sequences for d4awqb_:
Sequence, based on SEQRES records: (download)
>d4awqb_ d.122.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgkel hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgv gfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqte yleerrikeivkkhsqfigypitlfve
>d4awqb_ d.122.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgkel hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqdismigqfgvgfy saylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqteyle errikeivkkhsqfigypitlfve
Timeline for d4awqb_: