Lineage for d1ayrb1 (1ayr B:1-182)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9579Family b.1.1.5: E set domains [49208] (23 proteins)
  6. 9580Protein Arrestin [49244] (1 species)
  7. 9581Species Cow (Bos taurus) [TaxId:9913] [49245] (2 PDB entries)
  8. 9592Domain d1ayrb1: 1ayr B:1-182 [21917]

Details for d1ayrb1

PDB Entry: 1ayr (more details), 3.3 Å

PDB Description: arrestin from bovine rod outer segments

SCOP Domain Sequences for d1ayrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ayrb1 b.1.1.5 (B:1-182) Arrestin {Cow (Bos taurus)}
mkankpapnhvifkkisrdksvtiylgkrdyidhvervepvdgvvlvdpelvkgkrvyvs
ltcafrygqedidvmglsfrrdlyfsqvqvfppvgasgattrlqeslikklgantypfll
tfpdylpcsvmlqpapqdvgkscgvdfeikafathstdveedkipkkssvrllirkvqha
pr

SCOP Domain Coordinates for d1ayrb1:

Click to download the PDB-style file with coordinates for d1ayrb1.
(The format of our PDB-style files is described here.)

Timeline for d1ayrb1: