Lineage for d4avpb_ (4avp B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1984178Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1984179Protein automated matches [190154] (68 species)
    not a true protein
  7. 1984350Species Human (Homo sapiens) [TaxId:9606] [186924] (16 PDB entries)
  8. 1984367Domain d4avpb_: 4avp B: [219165]
    automated match to d1duxc_
    complexed with edo

Details for d4avpb_

PDB Entry: 4avp (more details), 1.82 Å

PDB Description: crystal structure of the dna-binding domain of human etv1.
PDB Compounds: (B:) ets translocation variant 1

SCOPe Domain Sequences for d4avpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4avpb_ a.4.5.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slqlwqflvallddpsnshfiawtgrgmefkliepeevarrwgiqknrpamnydklsrsl
ryyyekgimqkvageryvykfvcdpealfsmaf

SCOPe Domain Coordinates for d4avpb_:

Click to download the PDB-style file with coordinates for d4avpb_.
(The format of our PDB-style files is described here.)

Timeline for d4avpb_: