| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) ![]() |
| Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
| Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species) |
| Species Escherichia coli [TaxId:562] [48501] (26 PDB entries) |
| Domain d4auxa2: 4aux A:68-208 [219162] Other proteins in same PDB: d4auxa1 automated match to d2tcta2 complexed with cl, mg, xtc |
PDB Entry: 4aux (more details), 2.25 Å
SCOPe Domain Sequences for d4auxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4auxa2 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv
Timeline for d4auxa2: