Lineage for d1cf1d2 (1cf1 D:183-386)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9579Family b.1.1.5: E set domains [49208] (23 proteins)
  6. 9580Protein Arrestin [49244] (1 species)
  7. 9581Species Cow (Bos taurus) [TaxId:9913] [49245] (2 PDB entries)
  8. 9589Domain d1cf1d2: 1cf1 D:183-386 [21914]

Details for d1cf1d2

PDB Entry: 1cf1 (more details), 2.8 Å

PDB Description: arrestin from bovine rod outer segments
PDB Compounds: (D:)

SCOP Domain Sequences for d1cf1d2:

Sequence, based on SEQRES records: (download)

>d1cf1d2 b.1.1.5 (D:183-386) Arrestin {Cow (Bos taurus)}
dmgpqpraeaswqffmsdkplrlavslskeiyyhgepipvtvavtnstektvkkikvlve
qvtnvvlyssdyyiktvaaeeaqekvppnssltktltlvpllannrerrgialdgkikhe
dtnlasstiikegidktvmgilvsyqikvkltvsgllgeltssevatevpfrlmhpqped
pdtakesfqdenfvfeefarqnlk

Sequence, based on observed residues (ATOM records): (download)

>d1cf1d2 b.1.1.5 (D:183-386) Arrestin {Cow (Bos taurus)}
dmgpqpraeaswqffmsdkplrlavslskeiyyhgepipvtvavtnstektvkkikvlve
qvtnvvlyssdyyiktvaaeeaqekvppnssltktltlvpllannrerrgialdgkikhe
dtnlasstiikegidktvmgilvsyqikvkltvsgllgeltssevatevpfrlmhpqped
enfvfeefarqnlk

SCOP Domain Coordinates for d1cf1d2:

Click to download the PDB-style file with coordinates for d1cf1d2.
(The format of our PDB-style files is described here.)

Timeline for d1cf1d2: