Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries) |
Domain d4at6i1: 4at6 I:1-110 [219139] Other proteins in same PDB: d4at6b2, d4at6d2, d4at6f2, d4at6i2, d4at6k2, d4at6l2, d4at6m2, d4at6n2, d4at6o2, d4at6p2 automated match to d1q0xl1 |
PDB Entry: 4at6 (more details), 2.55 Å
SCOPe Domain Sequences for d4at6i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4at6i1 b.1.1.1 (I:1-110) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qavvtqesalttspgetvtltcrsstgavttsnyanwvqetpdhlftgliggtnnrapgv parfsgsligdkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlg
Timeline for d4at6i1: