Lineage for d4at6b2 (4at6 B:111-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2753118Domain d4at6b2: 4at6 B:111-212 [219134]
    Other proteins in same PDB: d4at6a_, d4at6b1, d4at6c_, d4at6d1, d4at6e_, d4at6f1, d4at6g_, d4at6h_, d4at6i1, d4at6j_, d4at6k1, d4at6l1, d4at6m1, d4at6m2, d4at6n1, d4at6o1, d4at6o2, d4at6p1
    automated match to d1q0xl2

Details for d4at6b2

PDB Entry: 4at6 (more details), 2.55 Å

PDB Description: fab fragment of antiporphyrin antibody 14h7
PDB Compounds: (B:) fab 14h7 light chain

SCOPe Domain Sequences for d4at6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4at6b2 b.1.1.2 (B:111-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq
snnkymassyltltarawerhssyscqvtheghtvekslsra

SCOPe Domain Coordinates for d4at6b2:

Click to download the PDB-style file with coordinates for d4at6b2.
(The format of our PDB-style files is described here.)

Timeline for d4at6b2: