Lineage for d4apva_ (4apv A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789342Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins)
    barrel, closed; n=5, S=10
  6. 2789537Protein automated matches [190206] (10 species)
    not a true protein
  7. 2789588Species Klebsiella pneumoniae [TaxId:573] [226356] (1 PDB entry)
  8. 2789589Domain d4apva_: 4apv A: [219097]
    automated match to d1v1qa_

Details for d4apva_

PDB Entry: 4apv (more details), 2.1 Å

PDB Description: The Klebsiella pneumoniae primosomal PriB protein: identification, crystal structure, and ssDNA binding mode
PDB Compounds: (A:) primosomal replication protein n

SCOPe Domain Sequences for d4apva_:

Sequence, based on SEQRES records: (download)

>d4apva_ b.40.4.3 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
tnrlelsgiicrtplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpviisghenqa
ithsitvgsavtvrgfischkaknglskmvlhaeqielids

Sequence, based on observed residues (ATOM records): (download)

>d4apva_ b.40.4.3 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
tnrlelsgiicrtplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpviisghenqa
ithsitvgsavtvrgfischkalskmvlhaeqielids

SCOPe Domain Coordinates for d4apva_:

Click to download the PDB-style file with coordinates for d4apva_.
(The format of our PDB-style files is described here.)

Timeline for d4apva_: