Lineage for d1cf1b1 (1cf1 B:9-182)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 291481Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 291805Family b.1.18.11: Arrestin [81291] (1 protein)
  6. 291806Protein Arrestin [49244] (2 species)
    duplication: contains tandem repeat of two elaborated Ig-like domains contacting each other head-to-head
  7. 291816Species Cow (Bos taurus), visual arrestin [TaxId:9913] [49245] (2 PDB entries)
  8. 291819Domain d1cf1b1: 1cf1 B:9-182 [21909]

Details for d1cf1b1

PDB Entry: 1cf1 (more details), 2.8 Å

PDB Description: arrestin from bovine rod outer segments

SCOP Domain Sequences for d1cf1b1:

Sequence, based on SEQRES records: (download)

>d1cf1b1 b.1.18.11 (B:9-182) Arrestin {Cow (Bos taurus), visual arrestin}
nhvifkkisrdksvtiylgkrdyidhvervepvdgvvlvdpelvkgkrvyvsltcafryg
qedidvmglsfrrdlyfsqvqvfppvgasgattrlqeslikklgantypflltfpdylpc
svmlqpapqdvgkscgvdfeikafathstdveedkipkkssvrllirkvqhapr

Sequence, based on observed residues (ATOM records): (download)

>d1cf1b1 b.1.18.11 (B:9-182) Arrestin {Cow (Bos taurus), visual arrestin}
nhvifkkisrdksvtiylgkrdyidhvervepvdgvvlvdpelvkgkrvyvsltcafryg
qsfrrdlyfsqvqvfppvgasgattrlqeslikklgantypflltfpdylpcsvmlqpap
qdvgkscgvdfeikafathstdveedkipkkssvrllirkvqhapr

SCOP Domain Coordinates for d1cf1b1:

Click to download the PDB-style file with coordinates for d1cf1b1.
(The format of our PDB-style files is described here.)

Timeline for d1cf1b1: