Lineage for d1cf1a1 (1cf1 A:10-182)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788950Superfamily b.1.18: E set domains [81296] (23 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 789547Family b.1.18.11: Arrestin/Vps26-like [81291] (1 protein)
  6. 789548Protein Arrestin [49244] (2 species)
    duplication: contains tandem repeat of two elaborated Ig-like domains contacting each other head-to-head
  7. 789560Species Cow (Bos taurus), visual arrestin [TaxId:9913] [49245] (2 PDB entries)
  8. 789561Domain d1cf1a1: 1cf1 A:10-182 [21907]

Details for d1cf1a1

PDB Entry: 1cf1 (more details), 2.8 Å

PDB Description: arrestin from bovine rod outer segments
PDB Compounds: (A:) protein (arrestin)

SCOP Domain Sequences for d1cf1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cf1a1 b.1.18.11 (A:10-182) Arrestin {Cow (Bos taurus), visual arrestin [TaxId: 9913]}
hvifkkisrdksvtiylgkrdyidhvervepvdgvvlvdpelvkgkrvyvsltcafrygq
edidvmglsfrrdlyfsqvqvfppvgasgattrlqeslikklgantypflltfpdylpcs
vmlqpapqdvgkscgvdfeikafathstdveedkipkkssvrllirkvqhapr

SCOP Domain Coordinates for d1cf1a1:

Click to download the PDB-style file with coordinates for d1cf1a1.
(The format of our PDB-style files is described here.)

Timeline for d1cf1a1: