SCOP 1.73: Domain d1doab_: 1doa B:

Lineage for d1doab_ (1doa B:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (20 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.8: RhoGDI-like [81288] (2 proteins)

6. Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [49243] (4 PDB entries)

8. Domain d1doab_: 1doa B: [21904]
   Other proteins in same PDB: d1doaa_

Details for d1doab_

PDB Entry: 1doa, 2.6 Å

PDB Description: Structure of the rho family gtp-binding protein cdc42 in complex with the multifunctional regulator rhogdi

PDB Compounds: (B:) protein (GDP-dissociation inhibitor 1)

SCOP Domain Sequences for d1doab_:

Sequence; same for both SEQRES and ATOM records:

>d1doab_ b.1.18.8 (B:) Rho GDP-dissociation inhibitor 1, RhoGDI {Cow (Bos taurus) [TaxId: 9913]}
eptaeqlaqiaaeneedehsvnykppaqksiqeiqeldkddeslrkykeallgrvavsad
pnvpnvvvtrltlvcstapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivs
gmkyiqhtyrkgvkidktdymvgsygpraeeyefltpmeeapkgmlargsyniksrftdd
drtdhlswewnltikkewkd

Timeline for d1doab_:

• d1doab_ first appeared (with stable ids) in SCOP 1.55
  
• d1doab_ appears in SCOP 1.71
  
• d1doab_ appears in SCOP 1.75
  
• d1doab_ appears in the current release, SCOPe 2.08