| Class b: All beta proteins [48724] (149 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (18 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.8: RhoGDI-like [81288] (2 proteins) |
| Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49242] (9 PDB entries) |
| Domain d1cc0f_: 1cc0 F: [21903] Other proteins in same PDB: d1cc0a_, d1cc0c_ |
PDB Entry: 1cc0 (more details), 5 Å
SCOP Domain Sequences for d1cc0f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cc0f_ b.1.18.8 (F:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens)}
svnykppaqksiqeiqeldkddeslrkykeallgrvavsadpnvpnvvvtgltlvcssap
gpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgmkyiqhtyrkgvkidktd
ymvgsygpraeeyefltpveeapkgmlargsysiksrftdddktdhlswewnltikkdwk
Timeline for d1cc0f_: