SCOPe 2.05: Domain d4al4c2: 4al4 C:160-331

Lineage for d4al4c2 (4al4 C:160-331)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein automated matches [226882] (7 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [226330] (13 PDB entries)

8. Domain d4al4c2: 4al4 C:160-331 [219025]
   Other proteins in same PDB: d4al4a1, d4al4b1, d4al4c1, d4al4d1
   automated match to d9ldta2
   complexed with gol, w7e

Details for d4al4c2

PDB Entry: 4al4, 1.78 Å

PDB Description: rat LDHA in complex with 2-((4-(2-((3-((2-methyl-1,3-benzothiazol-6- yl)amino)3-oxo-propyl)carbamoylamino)ethoxy)phenyl)methylpropanedioic acid

PDB Compounds: (C:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4al4c2:

Sequence; same for both SEQRES and ATOM records:

>d4al4c2 d.162.1.1 (C:160-331) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgvnvagvslkslnpqlgt
dadkeqwkdvhkqvvdsayeviklkgytswaiglsvadlaesimknlrrvhpistmikgl
ygikedvflsvpcilgqngisdvvkvtltpdeearlkksadtlwgiqkelqf

Timeline for d4al4c2:

• d4al4c2 first appeared in SCOPe 2.03
  
• d4al4c2 appears in SCOPe 2.04
  
• d4al4c2 appears in SCOPe 2.06
  
• d4al4c2 appears in the current release, SCOPe 2.08