SCOPe 2.06: Domain d4al4c1: 4al4 C:1-159

Lineage for d4al4c1 (4al4 C:1-159)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [226329] (13 PDB entries)

8. Domain d4al4c1: 4al4 C:1-159 [219024]
   Other proteins in same PDB: d4al4a2, d4al4b2, d4al4c2, d4al4d2
   automated match to d9ldta1
   complexed with gol, w7e

Details for d4al4c1

PDB Entry: 4al4, 1.78 Å

PDB Description: rat LDHA in complex with 2-((4-(2-((3-((2-methyl-1,3-benzothiazol-6- yl)amino)3-oxo-propyl)carbamoylamino)ethoxy)phenyl)methylpropanedioic acid

PDB Compounds: (C:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4al4c1:

Sequence; same for both SEQRES and ATOM records:

>d4al4c1 c.2.1.0 (C:1-159) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aalkdqlivnllkeeqvpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkyspqckllivsnpvdiltyvawkisgfpknrvig

Timeline for d4al4c1:

• d4al4c1 first appeared in SCOPe 2.03
  
• d4al4c1 appears in SCOPe 2.05
  
• d4al4c1 appears in SCOPe 2.07
  
• d4al4c1 appears in the current release, SCOPe 2.08