SCOP 1.71: Domain d1cc0e_: 1cc0 E:

Lineage for d1cc0e_ (1cc0 E:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.8: RhoGDI-like [81288] (2 proteins)

6. Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49242] (9 PDB entries)

8. Domain d1cc0e_: 1cc0 E: [21902]
   Other proteins in same PDB: d1cc0a_, d1cc0c_

Details for d1cc0e_

PDB Entry: 1cc0, 5 Å

PDB Description: crystal structure of the rhoa.gdp-rhogdi complex

SCOP Domain Sequences for d1cc0e_:

Sequence; same for both SEQRES and ATOM records:

>d1cc0e_ b.1.18.8 (E:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens)}
svnykppaqksiqeiqeldkddeslrkykeallgrvavsadpnvpnvvvtgltlvcssap
gpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgmkyiqhtyrkgvkidktd
ymvgsygpraeeyefltpveeapkgmlargsysiksrftdddktdhlswewnltikkdwk

Timeline for d1cc0e_:

• d1cc0e_ first appeared (with stable ids) in SCOP 1.55
  
• d1cc0e_ appears in SCOP 1.69
  
• d1cc0e_ appears in SCOP 1.73
  
• d1cc0e_ appears in the current release, SCOPe 2.08