Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
Superfamily d.167.1: Peptide deformylase [56420] (2 families) nickel-dependent enzyme |
Family d.167.1.1: Peptide deformylase [56421] (2 proteins) automatically mapped to Pfam PF01327 |
Protein automated matches [190200] (9 species) not a true protein |
Species Escherichia coli [TaxId:469008] [194798] (3 PDB entries) |
Domain d4al2a_: 4al2 A: [219016] automated match to d4az4a_ complexed with h2s, ni |
PDB Entry: 4al2 (more details), 2.6 Å
SCOPe Domain Sequences for d4al2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4al2a_ d.167.1.1 (A:) automated matches {Escherichia coli [TaxId: 469008]} svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekld
Timeline for d4al2a_: