SCOPe 2.06: Domain d4ajpd2: 4ajp D:160-331

Lineage for d4ajpd2 (4ajp D:160-331)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein automated matches [226882] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225057] (8 PDB entries)

8. Domain d4ajpd2: 4ajp D:160-331 [219004]
   Other proteins in same PDB: d4ajpa1, d4ajpb1, d4ajpc1, d4ajpd1
   automated match to d9ldta2
   complexed with 88n, gol, so4

Details for d4ajpd2

PDB Entry: 4ajp, 2.38 Å

PDB Description: Human LDHA in complex with 2-((4-(4-((3-((2-methyl-1,3-benzothiazol- 6yl)amino)-3-oxo-propyl)amino)-4-oxo-butyl)phenyl)methyl)propanedioic acid

PDB Compounds: (D:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4ajpd2:

Sequence; same for both SEQRES and ATOM records:

>d4ajpd2 d.162.1.1 (D:160-331) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgt
dkdkeqwkevhkqvvesayeviklkgytswaiglsvadlaesimknlrrvhpvstmikgl
ygikddvflsvpcilgqngisdlvkvtltseeearlkksadtlwgiqkelqf

Timeline for d4ajpd2:

• d4ajpd2 first appeared in SCOPe 2.03
  
• d4ajpd2 appears in SCOPe 2.05
  
• d4ajpd2 appears in SCOPe 2.07
  
• d4ajpd2 appears in the current release, SCOPe 2.08