Lineage for d4ajpd2 (4ajp D:160-331)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1680346Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1680347Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1680348Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1680640Protein automated matches [226882] (8 species)
    not a true protein
  7. 1680679Species Human (Homo sapiens) [TaxId:9606] [225057] (2 PDB entries)
  8. 1680687Domain d4ajpd2: 4ajp D:160-331 [219004]
    Other proteins in same PDB: d4ajpa1, d4ajpb1, d4ajpc1, d4ajpd1
    automated match to d9ldta2
    complexed with 0sn, gol, so4

Details for d4ajpd2

PDB Entry: 4ajp (more details), 2.38 Å

PDB Description: Human LDHA in complex with 2-((4-(4-((3-((2-methyl-1,3-benzothiazol- 6yl)amino)-3-oxo-propyl)amino)-4-oxo-butyl)phenyl)methyl)propanedioic acid
PDB Compounds: (D:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4ajpd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ajpd2 d.162.1.1 (D:160-331) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgt
dkdkeqwkevhkqvvesayeviklkgytswaiglsvadlaesimknlrrvhpvstmikgl
ygikddvflsvpcilgqngisdlvkvtltseeearlkksadtlwgiqkelqf

SCOPe Domain Coordinates for d4ajpd2:

Click to download the PDB-style file with coordinates for d4ajpd2.
(The format of our PDB-style files is described here.)

Timeline for d4ajpd2: