SCOPe 2.05: Domain d4ajpa1: 4ajp A:1-159

Lineage for d4ajpa1 (4ajp A:1-159)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (203 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186944] (39 PDB entries)

8. Domain d4ajpa1: 4ajp A:1-159 [218997]
   Other proteins in same PDB: d4ajpa2, d4ajpb2, d4ajpc2, d4ajpd2
   automated match to d9ldta1
   complexed with 88n, gol, so4

Details for d4ajpa1

PDB Entry: 4ajp, 2.38 Å

PDB Description: Human LDHA in complex with 2-((4-(4-((3-((2-methyl-1,3-benzothiazol- 6yl)amino)-3-oxo-propyl)amino)-4-oxo-butyl)phenyl)methyl)propanedioic acid

PDB Compounds: (A:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4ajpa1:

Sequence, based on SEQRES records:

>d4ajpa1 c.2.1.0 (A:1-159) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkyspnckllivsnpvdiltyvawkisgfpknrvig

Sequence, based on observed residues (ATOM records):

>d4ajpa1 c.2.1.0 (A:1-159) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atlkdqliynllkqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkgemm
dlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfiipn
vvkyspnckllivsnpvdiltyvawkisgfpknrvig

Timeline for d4ajpa1:

• d4ajpa1 first appeared in SCOPe 2.03
  
• d4ajpa1 appears in SCOPe 2.04
  
• d4ajpa1 appears in SCOPe 2.06
  
• d4ajpa1 appears in the current release, SCOPe 2.08