SCOPe 2.04: Domain d4ajob2: 4ajo B:160-331

Lineage for d4ajob2 (4ajo B:160-331)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein automated matches [226882] (8 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [226330] (12 PDB entries)

8. Domain d4ajob2: 4ajo B:160-331 [218992]
   Other proteins in same PDB: d4ajoa1, d4ajob1, d4ajoc1, d4ajod1
   automated match to d9ldta2
   complexed with 88n, dms, gol

Details for d4ajob2

PDB Entry: 4ajo, 1.96 Å

PDB Description: rat ldha in complex with 2-((4-(4-((3-((2-methyl-1,3-benzothiazol-6yl) amino)-3-oxo-propyl)amino)-4-oxo-butyl)phenyl)methyl)propanedioic acid

PDB Compounds: (B:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4ajob2:

Sequence; same for both SEQRES and ATOM records:

>d4ajob2 d.162.1.1 (B:160-331) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgvnvagvslkslnpqlgt
dadkeqwkdvhkqvvdsayeviklkgytswaiglsvadlaesimknlrrvhpistmikgl
ygikedvflsvpcilgqngisdvvkvtltpdeearlkksadtlwgiqkelqf

Timeline for d4ajob2:

• d4ajob2 first appeared in SCOPe 2.03
  
• d4ajob2 appears in SCOPe 2.05
  
• d4ajob2 appears in the current release, SCOPe 2.08