Lineage for d4ajna1 (4ajn A:2-159)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1580116Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1580117Protein automated matches [190069] (181 species)
    not a true protein
  7. 1581106Species Norway rat (Rattus norvegicus) [TaxId:10116] [226329] (12 PDB entries)
  8. 1581147Domain d4ajna1: 4ajn A:2-159 [218981]
    Other proteins in same PDB: d4ajna2, d4ajnb2, d4ajnc2, d4ajnd2
    automated match to d9ldta1
    complexed with 88v, gol

Details for d4ajna1

PDB Entry: 4ajn (more details), 2.1 Å

PDB Description: rat ldha in complex with 2-((4-(2-((3-((2-methyl-1,3-benzothiazol-6- yl)amino)-3-oxo-propyl)carbamoylamino)ethyl)phenyl)methyl) propanedioic acid
PDB Compounds: (A:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4ajna1:

Sequence, based on SEQRES records: (download)

>d4ajna1 c.2.1.0 (A:2-159) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
alkdqlivnllkeeqvpqnkitvvgvgavgmacaisilmkdladelalvdviedklkgem
mdlqhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfiip
nvvkyspqckllivsnpvdiltyvawkisgfpknrvig

Sequence, based on observed residues (ATOM records): (download)

>d4ajna1 c.2.1.0 (A:2-159) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
alkdqlivnllkeqvpqnkitvvgvgavgmacaisilmkdladelalvdviedklkgemm
dlqhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfiipn
vvkyspqckllivsnpvdiltyvawkisgfpknrvig

SCOPe Domain Coordinates for d4ajna1:

Click to download the PDB-style file with coordinates for d4ajna1.
(The format of our PDB-style files is described here.)

Timeline for d4ajna1: