Lineage for d4ajla2 (4ajl A:160-331)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2232528Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2232529Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2232530Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2232895Protein automated matches [226882] (7 species)
    not a true protein
  7. 2232961Species Norway rat (Rattus norvegicus) [TaxId:10116] [226330] (13 PDB entries)
  8. 2232966Domain d4ajla2: 4ajl A:160-331 [218974]
    Other proteins in same PDB: d4ajla1, d4ajlb1, d4ajlc1, d4ajld1
    automated match to d9ldta2
    complexed with 88w, dms, gol, mli

Details for d4ajla2

PDB Entry: 4ajl (more details), 1.77 Å

PDB Description: rat ldha in complex with 3-(ethylcarbamoylamino)-n-(2-methyl-1,3- benzothiazol-6-yl)propanamide
PDB Compounds: (A:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4ajla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ajla2 d.162.1.1 (A:160-331) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgvnvagvslkslnpqlgt
dadkeqwkdvhkqvvdsayeviklkgytswaiglsvadlaesimknlrrvhpistmikgl
ygikedvflsvpcilgqngisdvvkvtltpdeearlkksadtlwgiqkelqf

SCOPe Domain Coordinates for d4ajla2:

Click to download the PDB-style file with coordinates for d4ajla2.
(The format of our PDB-style files is described here.)

Timeline for d4ajla2: