Lineage for d1ksr__ (1ksr -)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 291481Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 291797Family b.1.18.10: Filamin repeat (rod domain) [81290] (1 protein)
  6. 291798Protein F-actin cross-linking gelation factor (ABP-120) repeats [49239] (1 species)
  7. 291799Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [49240] (2 PDB entries)
  8. 291804Domain d1ksr__: 1ksr - [21897]
    one repeat (Rod 4)

Details for d1ksr__

PDB Entry: 1ksr (more details)

PDB Description: the repeating segments of the f-actin cross-linking gelation factor (abp-120) have an immunoglobulin fold, nmr, 20 structures

SCOP Domain Sequences for d1ksr__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ksr__ b.1.18.10 (-) F-actin cross-linking gelation factor (ABP-120) repeats {Slime mold (Dictyostelium discoideum)}
adpeksyaegpgldggecfqpskfkihavdpdgvhrtdggdgfvvtiegpapvdpvmvdn
gdgtydvefepkeagdyvinltldgdnvngfpktvtvkpa

SCOP Domain Coordinates for d1ksr__:

Click to download the PDB-style file with coordinates for d1ksr__.
(The format of our PDB-style files is described here.)

Timeline for d1ksr__: