SCOP 1.63: Domain d1qfhb2: 1qfh B:750-857

Lineage for d1qfhb2 (1qfh B:750-857)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (17 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.10: Filamin repeat (rod domain) [81290] (1 protein)

6. Protein F-actin cross-linking gelation factor (ABP-120) repeats [49239] (1 species)

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [49240] (2 PDB entries)

8. Domain d1qfhb2: 1qfh B:750-857 [21896]
   Rod domains 5 and 6

Details for d1qfhb2

PDB Entry: 1qfh, 2.2 Å

PDB Description: dimerization of gelation factor from dictyostelium discoideum: crystal structure of rod domains 5 and 6

SCOP Domain Sequences for d1qfhb2:

Sequence; same for both SEQRES and ATOM records:

>d1qfhb2 b.1.18.10 (B:750-857) F-actin cross-linking gelation factor (ABP-120) repeats {Slime mold (Dictyostelium discoideum)}
gangedssfgsftftvaaknkkgevktyggdkfevsitgpaeeitldaidnqdgtytaay
slvgngrfstgvklngkhiegspfkqvlgnpgkknpevksftttrtan

Timeline for d1qfhb2:

• d1qfhb2 first appeared (with stable ids) in SCOP 1.55
  
• d1qfhb2 appears in SCOP 1.61
  
• d1qfhb2 appears in SCOP 1.65
  
• d1qfhb2 appears in the current release, SCOPe 2.08