SCOPe 2.05: Domain d1qfhb1: 1qfh B:646-749

Lineage for d1qfhb1 (1qfh B:646-749)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins)
   Pfam PF00630

6. Protein F-actin cross-linking gelation factor (ABP-120) repeats [49239] (1 species)

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [49240] (3 PDB entries)
   Uniprot P13466 547-857

8. Domain d1qfhb1: 1qfh B:646-749 [21895]
   Rod domains 5 and 6

Details for d1qfhb1

PDB Entry: 1qfh, 2.2 Å

PDB Description: dimerization of gelation factor from dictyostelium discoideum: crystal structure of rod domains 5 and 6

PDB Compounds: (B:) protein (gelation factor)

SCOPe Domain Sequences for d1qfhb1:

Sequence; same for both SEQRES and ATOM records:

>d1qfhb1 b.1.18.10 (B:646-749) F-actin cross-linking gelation factor (ABP-120) repeats {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
kpapsaehsyaegeglvkvfdnapaeftifavdtkgvartdggdpfevaingpdglvvda
kvtdnndgtygvvydapvegnynvnvtlrgnpiknmpidvkcie

Timeline for d1qfhb1:

• d1qfhb1 first appeared (with stable ids) in SCOP 1.55
  
• d1qfhb1 appears in SCOPe 2.04
  
• d1qfhb1 appears in SCOPe 2.06
  
• d1qfhb1 appears in the current release, SCOPe 2.08