Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
Protein automated matches [226882] (8 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [226330] (12 PDB entries) |
Domain d4ajhc2: 4ajh C:160-331 [218946] Other proteins in same PDB: d4ajha1, d4ajhb1, d4ajhc1, d4ajhd1 automated match to d9ldta2 complexed with 2b4, 88s, gol, mli |
PDB Entry: 4ajh (more details), 1.93 Å
SCOPe Domain Sequences for d4ajhc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ajhc2 d.162.1.1 (C:160-331) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgvnvagvslkslnpqlgt dadkeqwkdvhkqvvdsayeviklkgytswaiglsvadlaesimknlrrvhpistmikgl ygikedvflsvpcilgqngisdvvkvtltpdeearlkksadtlwgiqkelqf
Timeline for d4ajhc2: