Lineage for d4ajha2 (4ajh A:160-331)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556795Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2556796Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2556797Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2557171Protein automated matches [226882] (9 species)
    not a true protein
  7. 2557237Species Norway rat (Rattus norvegicus) [TaxId:10116] [226330] (13 PDB entries)
  8. 2557254Domain d4ajha2: 4ajh A:160-331 [218942]
    Other proteins in same PDB: d4ajha1, d4ajhb1, d4ajhc1, d4ajhd1
    automated match to d9ldta2
    complexed with 2b4, 88s, gol, mli

Details for d4ajha2

PDB Entry: 4ajh (more details), 1.93 Å

PDB Description: rat ldha in complex with n-(2-methyl-1,3-benzothiazol-6-yl)-3-ureido- propanamide and 2-(4-bromophenoxy)propanedioic acid
PDB Compounds: (A:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4ajha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ajha2 d.162.1.1 (A:160-331) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgvnvagvslkslnpqlgt
dadkeqwkdvhkqvvdsayeviklkgytswaiglsvadlaesimknlrrvhpistmikgl
ygikedvflsvpcilgqngisdvvkvtltpdeearlkksadtlwgiqkelqf

SCOPe Domain Coordinates for d4ajha2:

Click to download the PDB-style file with coordinates for d4ajha2.
(The format of our PDB-style files is described here.)

Timeline for d4ajha2: