SCOPe 2.03: Domain d4ajed1: 4aje D:2-159

Lineage for d4ajed1 (4aje D:2-159)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (159 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [226329] (12 PDB entries)

8. Domain d4ajed1: 4aje D:2-159 [218939]
   Other proteins in same PDB: d4ajea2, d4ajeb2, d4ajec2, d4ajed2
   automated match to d9ldta1
   complexed with 2b4, gol, mli

Details for d4ajed1

PDB Entry: 4aje, 2.35 Å

PDB Description: rat ldha in complex with 2-(4-bromophenoxy)propanedioic acid

PDB Compounds: (D:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4ajed1:

Sequence; same for both SEQRES and ATOM records:

>d4ajed1 c.2.1.0 (D:2-159) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
alkdqlivnllkeeqvpqnkitvvgvgavgmacaisilmkdladelalvdviedklkgem
mdlqhgslflktpkivsskdysvtansklviitagarqqegesrlnlvqrnvnifkfiip
nvvkyspqckllivsnpvdiltyvawkisgfpknrvig

Timeline for d4ajed1:

• d4ajed1 is new in SCOPe 2.03-stable
  
• d4ajed1 appears in SCOPe 2.04
  
• d4ajed1 appears in the current release, SCOPe 2.08