SCOP 1.65: Domain d1qfha1: 1qfh A:646-749

Lineage for d1qfha1 (1qfh A:646-749)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.10: Filamin repeat (rod domain) [81290] (1 protein)

6. Protein F-actin cross-linking gelation factor (ABP-120) repeats [49239] (1 species)

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [49240] (2 PDB entries)

8. Domain d1qfha1: 1qfh A:646-749 [21893]

Details for d1qfha1

PDB Entry: 1qfh, 2.2 Å

PDB Description: dimerization of gelation factor from dictyostelium discoideum: crystal structure of rod domains 5 and 6

SCOP Domain Sequences for d1qfha1:

Sequence; same for both SEQRES and ATOM records:

>d1qfha1 b.1.18.10 (A:646-749) F-actin cross-linking gelation factor (ABP-120) repeats {Slime mold (Dictyostelium discoideum)}
kpapsaehsyaegeglvkvfdnapaeftifavdtkgvartdggdpfevaingpdglvvda
kvtdnndgtygvvydapvegnynvnvtlrgnpiknmpidvkcie

Timeline for d1qfha1:

• d1qfha1 first appeared (with stable ids) in SCOP 1.55
  
• d1qfha1 appears in SCOP 1.63
  
• d1qfha1 appears in SCOP 1.67
  
• d1qfha1 appears in the current release, SCOPe 2.08