Lineage for d1qfha1 (1qfh A:646-749)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 223262Superfamily b.1.18: E set domains [81296] (17 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 223549Family b.1.18.10: Filamin repeat (rod domain) [81290] (1 protein)
  6. 223550Protein F-actin cross-linking gelation factor (ABP-120) repeats [49239] (1 species)
  7. 223551Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [49240] (2 PDB entries)
  8. 223552Domain d1qfha1: 1qfh A:646-749 [21893]

Details for d1qfha1

PDB Entry: 1qfh (more details), 2.2 Å

PDB Description: dimerization of gelation factor from dictyostelium discoideum: crystal structure of rod domains 5 and 6

SCOP Domain Sequences for d1qfha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qfha1 b.1.18.10 (A:646-749) F-actin cross-linking gelation factor (ABP-120) repeats {Slime mold (Dictyostelium discoideum)}
kpapsaehsyaegeglvkvfdnapaeftifavdtkgvartdggdpfevaingpdglvvda
kvtdnndgtygvvydapvegnynvnvtlrgnpiknmpidvkcie

SCOP Domain Coordinates for d1qfha1:

Click to download the PDB-style file with coordinates for d1qfha1.
(The format of our PDB-style files is described here.)

Timeline for d1qfha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qfha2