Lineage for d1euu_1 (1euu 403-505)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54510Family b.1.1.5: E set domains [49208] (24 proteins)
  6. 54708Protein Sialidase, "linker" domain [49237] (1 species)
  7. 54709Species Micromonospora viridifaciens [TaxId:1881] [49238] (2 PDB entries)
  8. 54711Domain d1euu_1: 1euu 403-505 [21892]
    Other proteins in same PDB: d1euu_2, d1euu_3

Details for d1euu_1

PDB Entry: 1euu (more details), 2.5 Å

PDB Description: sialidase or neuraminidase, large 68kd form

SCOP Domain Sequences for d1euu_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1euu_1 b.1.1.5 (403-505) Sialidase, "linker" domain {Micromonospora viridifaciens}
gicapftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrq
akgqvtitvpagttpgryrvgatlrtsagnasttftvtvglld

SCOP Domain Coordinates for d1euu_1:

Click to download the PDB-style file with coordinates for d1euu_1.
(The format of our PDB-style files is described here.)

Timeline for d1euu_1: