Lineage for d4aj0c1 (4aj0 C:2-95)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742289Domain d4aj0c1: 4aj0 C:2-95 [218906]
    Other proteins in same PDB: d4aj0a2, d4aj0b2, d4aj0c2, d4aj0d2
    automated match to d1cd0b_
    complexed with act, pg0

Details for d4aj0c1

PDB Entry: 4aj0 (more details), 1.7 Å

PDB Description: Crystallographic structure of an amyloidogenic variant, 3rCW, of the germinal line lambda 3
PDB Compounds: (C:) germinal line lambda 3 3rcw variant

SCOPe Domain Sequences for d4aj0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aj0c1 b.1.1.1 (C:2-95) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yeltqppsvsvspgqtasitcsgdklgdkyaywyqqkpgqspvlviyqdskrpsgiperf
sgsnsgntatltisgtqamdeadyycqaadssta

SCOPe Domain Coordinates for d4aj0c1:

Click to download the PDB-style file with coordinates for d4aj0c1.
(The format of our PDB-style files is described here.)

Timeline for d4aj0c1: