SCOPe 2.04: Domain d4aj0b_: 4aj0 B:

Lineage for d4aj0b_ (4aj0 B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (96 PDB entries)

8. Domain d4aj0b_: 4aj0 B: [218905]
   automated match to d1cd0b_
   complexed with act, pg0

Details for d4aj0b_

PDB Entry: 4aj0, 1.7 Å

PDB Description: Crystallographic structure of an amyloidogenic variant, 3rCW, of the germinal line lambda 3

PDB Compounds: (B:) germinal line lambda 3 3rcw variant

SCOPe Domain Sequences for d4aj0b_:

Sequence; same for both SEQRES and ATOM records:

>d4aj0b_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
syeltqppsvsvspgqtasitcsgdklgdkyaywyqqkpgqspvlviyqdskrpsgiper
fsgsnsgntatltisgtqamdeadyycqaadsstavvfgggtkltvl

Timeline for d4aj0b_:

• d4aj0b_ first appeared in SCOPe 2.03
  
• d4aj0b_ appears in SCOPe 2.05
  
• d4aj0b_ appears in the current release, SCOPe 2.08, called d4aj0b1