SCOPe 2.07: Domain d4aizd_: 4aiz D:

Lineage for d4aizd_ (4aiz D:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d4aizd_: 4aiz D: [218903]
   automated match to d1cd0b_
   complexed with 88q, cit, so4

Details for d4aizd_

PDB Entry: 4aiz, 1.75 Å

PDB Description: Crystallographic structure of 3mJL2 from the germinal line lambda 3

PDB Compounds: (D:) v2-17 protein

SCOPe Domain Sequences for d4aizd_:

Sequence; same for both SEQRES and ATOM records:

>d4aizd_ b.1.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elmqppsvsvspgqtaritcsgdalpkqyaywyqqkpgqapvlviykdserpsgiperfs
gsssgttvtltisgvqaedeadyycqsadssgtyvvfgggtkltvl

Timeline for d4aizd_:

• d4aizd_ first appeared in SCOPe 2.03
  
• d4aizd_ appears in SCOPe 2.06
  
• d4aizd_ appears in the current release, SCOPe 2.08, called d4aizd1