SCOPe 2.05: Domain d4aixb_: 4aix B:

Lineage for d4aixb_ (4aix B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (18 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (120 PDB entries)

8. Domain d4aixb_: 4aix B: [218897]
   automated match to d1cd0b_

Details for d4aixb_

PDB Entry: 4aix, 1.8 Å

PDB Description: Crystallographic structure of an amyloidogenic variant, 3rC34Y, of the germinal line lambda 3

PDB Compounds: (B:) ig lambda chain v-IV region bau

SCOPe Domain Sequences for d4aixb_:

Sequence; same for both SEQRES and ATOM records:

>d4aixb_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yeltqppsvsvspgqtasitcsgdklgdkyaywyqqkpgqspvlviyqdskrpsgiperf
sgsnsgntatltisgtqamdeadyycqawdsstavvfgggtkltvl

Timeline for d4aixb_:

• d4aixb_ first appeared in SCOPe 2.03
  
• d4aixb_ appears in SCOPe 2.04
  
• d4aixb_ appears in SCOPe 2.06
  
• d4aixb_ appears in the current release, SCOPe 2.08, called d4aixb1