SCOPe 2.05: Domain d4aiea2: 4aie A:466-538

Lineage for d4aiea2 (4aie A:466-538)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (30 species)
   not a true protein

7. Species Lactobacillus acidophilus [TaxId:272621] [226448] (1 PDB entry)

8. Domain d4aiea2: 4aie A:466-538 [218894]
   Other proteins in same PDB: d4aiea1
   automated match to d1uoka1
   complexed with ca, gol, mes

Details for d4aiea2

PDB Entry: 4aie, 2.05 Å

PDB Description: structure of glucan-1,6-alpha-glucosidase from lactobacillus acidophilus ncfm

PDB Compounds: (A:) glucan 1,6-alpha-glucosidase

SCOPe Domain Sequences for d4aiea2:

Sequence; same for both SEQRES and ATOM records:

>d4aiea2 b.71.1.0 (A:466-538) automated matches {Lactobacillus acidophilus [TaxId: 272621]}
gdfslvsntqdavlayyrilndkkwlvvanlsneeqnfvsndqietilsnypernnvqni
tlkpyeafiskvi

Timeline for d4aiea2:

• d4aiea2 first appeared in SCOPe 2.03
  
• d4aiea2 appears in SCOPe 2.04
  
• d4aiea2 appears in SCOPe 2.06
  
• d4aiea2 appears in the current release, SCOPe 2.08