Lineage for d4ahcb1 (4ahc B:1-347)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1859086Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1860195Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 1860196Protein automated matches [190396] (30 species)
    not a true protein
  7. 1860388Species Pyrococcus furiosus [TaxId:2261] [224898] (3 PDB entries)
  8. 1860390Domain d4ahcb1: 4ahc B:1-347 [218868]
    Other proteins in same PDB: d4ahca2, d4ahcb2
    automated match to d2vwja1
    complexed with gol

Details for d4ahcb1

PDB Entry: 4ahc (more details), 2.4 Å

PDB Description: Crystal Structure of an Evolved Replicating DNA Polymerase
PDB Compounds: (B:) DNA polymerase

SCOPe Domain Sequences for d4ahcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ahcb1 c.55.3.0 (B:1-347) automated matches {Pyrococcus furiosus [TaxId: 2261]}
mildvdyiteegkpvirlfkkengkfkiehdrtfrpyiyallrddskieevkkitgerhg
kivrivdvekvekkflgkpitvwklylehpqdqptirekvrehpavvdifeydipfakry
lidkglipmegeeelkilafaiatlyhegeefgkgpiimisyadeneakvitwknidlpy
vevvsseremikrflriirekdpdiivtyngdsfdfpylakraeklgikltigrdgsepk
mqrigdmtavevkgrihfdlyhvitrtinlptytleavyeaifgkpkekvyadeiakawe
sgenlervakysmedakatyelgkeflpmeiqlsrligqplwdvsrs

SCOPe Domain Coordinates for d4ahcb1:

Click to download the PDB-style file with coordinates for d4ahcb1.
(The format of our PDB-style files is described here.)

Timeline for d4ahcb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ahcb2