Lineage for d4ah2a1 (4ah2 A:4-83)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938673Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)
  8. 2938834Domain d4ah2a1: 4ah2 A:4-83 [218858]
    Other proteins in same PDB: d4ah2a2
    automated match to d1muja2
    complexed with gol

Details for d4ah2a1

PDB Entry: 4ah2 (more details), 2.36 Å

PDB Description: hla-dr1 with covalently linked clip106-120 in canonical orientation
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d4ah2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ah2a1 d.19.1.0 (A:4-83) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
avdkanleimtkrsnytpit

SCOPe Domain Coordinates for d4ah2a1:

Click to download the PDB-style file with coordinates for d4ah2a1.
(The format of our PDB-style files is described here.)

Timeline for d4ah2a1: