Lineage for d1ggua1 (1ggu A:8-190)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54510Family b.1.1.5: E set domains [49208] (24 proteins)
  6. 54719Protein Transglutaminase N-terminal domain [49235] (2 species)
  7. 54720Species Human (Homo sapiens) [TaxId:9606] [49236] (7 PDB entries)
  8. 54725Domain d1ggua1: 1ggu A:8-190 [21885]
    Other proteins in same PDB: d1ggua2, d1ggua3, d1ggua4, d1ggub2, d1ggub3, d1ggub4

Details for d1ggua1

PDB Entry: 1ggu (more details), 2.1 Å

PDB Description: human factor xiii with calcium bound in the ion site

SCOP Domain Sequences for d1ggua1:

Sequence, based on SEQRES records: (download)

>d1ggua1 b.1.1.5 (A:8-190) Transglutaminase N-terminal domain {Human (Homo sapiens)}
fggrravppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlfkerwdtnkvdhhtd
kyennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqs
gkwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpw
ced

Sequence, based on observed residues (ATOM records): (download)

>d1ggua1 b.1.1.5 (A:8-190) Transglutaminase N-terminal domain {Human (Homo sapiens)}
fggrravppnnsnaaeddlptveeflnvtsvhlfkerwdtnkvdhhtdkyennklivrrg
qsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgkwgakivmred
rsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwced

SCOP Domain Coordinates for d1ggua1:

Click to download the PDB-style file with coordinates for d1ggua1.
(The format of our PDB-style files is described here.)

Timeline for d1ggua1: