Lineage for d4afgb_ (4afg B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2819475Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2819476Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2819945Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2819946Protein automated matches [193506] (5 species)
    not a true protein
  7. 2820428Species Capitella teleta [TaxId:283909] [193507] (3 PDB entries)
  8. 2820435Domain d4afgb_: 4afg B: [218829]
    automated match to d4b5dc_
    complexed with qmr

Details for d4afgb_

PDB Entry: 4afg (more details), 2 Å

PDB Description: capitella teleta achbp in complex with varenicline
PDB Compounds: (B:) capitella teleta achbp

SCOPe Domain Sequences for d4afgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4afgb_ b.96.1.0 (B:) automated matches {Capitella teleta [TaxId: 283909]}
nglmakrlrrellntyeqlgksglpflddigkvdvkfglslqllksieqrgmgfnsigtf
kaivklswvdtilrwdpeppfdfqkieispdeiwtpdiklfnsvdldmtldrttqaivfs
ngtvlwippavlkvlcvsqddvdschfqfgswvysvdevdihfmddkaevlldfyqdsle
ilensaqrqevvypccesayvemkyllalrse

SCOPe Domain Coordinates for d4afgb_:

Click to download the PDB-style file with coordinates for d4afgb_.
(The format of our PDB-style files is described here.)

Timeline for d4afgb_: