SCOPe 2.07: Domain d4aenb2: 4aen B:93-190

Lineage for d4aenb2 (4aen B:93-190)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d4aenb2: 4aen B:93-190 [218816]
   Other proteins in same PDB: d4aena1, d4aena2, d4aenb1
   automated match to d1fv1b1
   complexed with gol

Details for d4aenb2

PDB Entry: 4aen, 2.2 Å

PDB Description: HLA-DR1 with covalently linked CLIP106-120 in reversed orientation

PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d4aenb2:

Sequence, based on SEQRES records:

>d4aenb2 b.1.1.2 (B:93-190) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

Sequence, based on observed residues (ATOM records):

>d4aenb2 b.1.1.2 (B:93-190) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrvepkvtvypsknllvcsvsgfypgsievrwfrngqeekagvvstgliqngdwtfqtlv
mletvprsgevytcqvehpsvtspltvewra

Timeline for d4aenb2:

• d4aenb2 first appeared in SCOPe 2.03
  
• d4aenb2 appears in SCOPe 2.06
  
• d4aenb2 appears in the current release, SCOPe 2.08