Lineage for d4aena2 (4aen A:84-180)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1519493Domain d4aena2: 4aen A:84-180 [218814]
    Other proteins in same PDB: d4aena1, d4aenb1, d4aenb2
    automated match to d1muja1
    complexed with gol

Details for d4aena2

PDB Entry: 4aen (more details), 2.2 Å

PDB Description: HLA-DR1 with covalently linked CLIP106-120 in reversed orientation
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d4aena2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4aena2 b.1.1.0 (A:84-180) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpredh
lfrkfhylpflpstedvydcrvehwgldepllkhwef

SCOPe Domain Coordinates for d4aena2:

Click to download the PDB-style file with coordinates for d4aena2.
(The format of our PDB-style files is described here.)

Timeline for d4aena2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4aena1