Lineage for d1fiea1 (1fie A:9-190)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54510Family b.1.1.5: E set domains [49208] (24 proteins)
  6. 54719Protein Transglutaminase N-terminal domain [49235] (2 species)
  7. 54720Species Human (Homo sapiens) [TaxId:9606] [49236] (7 PDB entries)
  8. 54727Domain d1fiea1: 1fie A:9-190 [21879]
    Other proteins in same PDB: d1fiea2, d1fiea3, d1fiea4, d1fieb2, d1fieb3, d1fieb4

Details for d1fiea1

PDB Entry: 1fie (more details), 2.5 Å

PDB Description: recombinant human coagulation factor xiii

SCOP Domain Sequences for d1fiea1:

Sequence, based on SEQRES records: (download)

>d1fiea1 b.1.1.5 (A:9-190) Transglutaminase N-terminal domain {Human (Homo sapiens)}
ggrravppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlfkerwdtnkvdhhtdk
yennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsg
kwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwc
ed

Sequence, based on observed residues (ATOM records): (download)

>d1fiea1 b.1.1.5 (A:9-190) Transglutaminase N-terminal domain {Human (Homo sapiens)}
ggrravppnnsnaaeddlptvflnvtsvhlfkerwdtnkvdhhtdkyennklivrrgqsf
yvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgkwgakivmredrsv
rlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwced

SCOP Domain Coordinates for d1fiea1:

Click to download the PDB-style file with coordinates for d1fiea1.
(The format of our PDB-style files is described here.)

Timeline for d1fiea1: